PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010086870.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family LBD
Protein Properties Length: 252aa    MW: 27518.2 Da    PI: 7.968
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010086870.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260127.65.8e-4091081100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrrkC+++Cv+apyfp +qp+kfa vhk++Gasnv k+l++l   +re+a+ sl+yeAear+rdPv G+vg+i+ l+++l+q +ae++
  XP_010086870.1   9 PCAACKFLRRKCTQECVFAPYFPPDQPQKFASVHKVYGASNVAKILNELTVVHREEAAISLAYEAEARLRDPVFGCVGFITILHNRLKQIQAEVH 103
                     7********************************************************************************************** PP

          DUF260  96 llkee 100
                     + k+e
  XP_010086870.1 104 ASKKE 108
                     99887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.3598109IPR004883Lateral organ boundaries, LOB
PfamPF031954.6E-399105IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 252 aa     Download sequence    Send to blast
MASSSSHSPC AACKFLRRKC TQECVFAPYF PPDQPQKFAS VHKVYGASNV AKILNELTVV  60
HREEAAISLA YEAEARLRDP VFGCVGFITI LHNRLKQIQA EVHASKKELA TYIGPQAMMV  120
MMPPPPSYGM APPPPPTLGI QPTNNASAQL LIREPMNAQQ YHHHQQQMFN SGFDHVPPVS  180
GGFSNQMNGG GRGSPSGGVV SPSLGLGGFD NVPNYHIQSQ QQQVHPPPLD YQLQTQLIIS  240
SQQKSEGDHQ QN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010086870.10.0hypothetical protein L484_005283
SwissprotQ9FKZ39e-64LBD36_ARATH; LOB domain-containing protein 36
TrEMBLW9QIY40.0W9QIY4_9R
STRINGVIT_07s0197g00020.t011e-71(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23533484
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.18e-58ASYMMETRIC LEAVES 2-like 1